Recombinant Rat Steroid 5 Alpha Reductase 1

Synonyms: 3-Oxo-5 Alpha-Steroid Delta 4-Dehydrogenase Alpha 1

UOM: 50ug/200ug

Activity： Not tested

Source: Prokaryotic expression

Endotoxin Level：Untreated

Host: E.coli

Original Concentration: 500µg/mL

Original Structure: Rat

Swiss Prot: P24008

Residues: Val146~Leu259

Traits: Freeze-dried powder

Tags: N-terminal His and GST Tag

Buffer formulation: PBS（PH7.4)）, containing 5% Trehalose.

Subcellular Location: Endoplasmic reticulum lumen

Purity: >90%

Applications: Positive Control; Immunogen; SDS-PAGE; WB

(May be suitable for use in other assays to be determined by the end user.)

Predicted isoelectric point: 9.1

Predicted Molecular Mass: 43.0kDa

Accurate Molecular Mass: 45kDa as determined by SDS-PAGE reducing conditions.

USAGE

Reconstitute in PBS (pH7.4) to a concentration of 0.1-0.5 mg/mL. Do not vortex

STORAGE AND STABILITY

Storage: Avoid repeated freeze/thaw cycles. Store at 2-8ºC for one month.

Aliquot and store at -80ºC for 12 months.

Stability Test: The thermal stability is described by the loss rate. The loss rate was determined by

accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious

degradation and precipitation were observed. The loss rate is less than 5% within the expiration

date under appropriate storage condition.

SEQUENCE

VTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSAANYFGELVEWCGFALASW SLQGVVFALFTLSTLLTRAKQHHQWYHEKFEDYPKSRKILIPFVL